PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780662.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 245aa    MW: 27141.4 Da    PI: 8.7734
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780662.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.22.1e-31169225158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  XP_009780662.1 169 QEPVFVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 225
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34167228IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.027168228IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-26170225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.3E-23171193IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860173193IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.3E-23202225IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MQSKSKSAIC REARTFNVPN SIVYSEPWWN TAGYNPVSLG LMRECASDSS SREQSVDGRS  60
QSDGGAKEED DDAPENSQST IPMHSDGERS YPQVDQNLQP IASTIPPKGD GTQIHPGQLE  120
PVMHSIACAP NLYADLYYGG MMTPFGQPMV PHVLDMHHPR MPLPHEMAQE PVFVNAKQYH  180
GILRRRESRA KAELEKKLIK VRKPYLHESR HQHALKRARA SGGRFAKKSD TDTSKGTGSG  240
SGSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18169241274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2459772e-68AC245977.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-58j6 map 1, complete sequence.
GenBankAC2461062e-68AC246106.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-9i12 map 1, complete sequence.
GenBankAC2466232e-68AC246623.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-36c24 map 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780662.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like
TrEMBLA0A0V0HY241e-139A0A0V0HY24_SOLCH; Putative nuclear transcription factor Y subunit A-1-like
STRINGPGSC0003DMT4000277851e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-46nuclear factor Y, subunit A1